If you have been reading about Nicotinamide riboside and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-03-11. Numbers and descriptions here follow the published literature rather than marketing material.
NMN is generally handled as a hygroscopic and light-sensitive solid in laboratory settings. Recommended storage is typically at -20°C or below, often under desiccation and protected from light. Aqueous solutions are less stable than the solid and may degrade through hydrolysis or other pathways, so fresh preparation is common for analytical work. Repeated freeze-thaw cycles can reduce sample integrity. Stability depends on pH, temperature, buffer composition, and the presence of metal ions, so specific shelf-life values should be determined experimentally rather than assumed.
Quality control for NMN samples often includes purity determination by HPLC, identity confirmation by mass spectrometry or NMR, and water content measurement by Karl Fischer titration. Certificates of analysis may report residual solvents, heavy metals, and microbial limits depending on the intended use. Purity values are method-dependent, so a stated percentage should be interpreted alongside the analytical procedure and detection wavelength. Reference standards help ensure that retention times and spectral data are comparable across laboratories. Researchers increasingly request independent verification because supply chains for specialty chemicals can vary in documentation.
Research on NMN has expanded because NAD+ concentrations decline with age in some tissues and because NAD+ participates in energy metabolism, DNA repair, and signaling. Animal studies have reported changes in NAD+ levels after NMN administration, but human data are more limited and often focus on safety, pharmacokinetics, and biomarker changes. Questions remain about oral absorption, tissue distribution, and whether changes in blood NAD+ reflect changes inside specific organs. NMN is not an approved drug, and claims about its clinical effects should be distinguished from established biochemical findings.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. The compound exists in cells as an intermediate in the production of nicotinamide adenine dinucleotide, a central redox cofactor. NMN is distinct from nicotinamide riboside, another related pyridine nucleotide, although the two compounds can converge in metabolic pathways. Its chemical formula is C11H15N2O8P, and it carries a net negative charge at physiological pH.
In the salvage pathway, NMN is generated from nicotinamide and 5-phosphoribosyl-1-pyrophosphate by the enzyme nicotinamide phosphoribosyltransferase. A second route produces NMN from nicotinamide riboside through phosphorylation by nicotinamide riboside kinases. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferases, often called NMNAT enzymes. This stepwise route allows cells to recycle nicotinamide and maintain NAD+ levels under changing metabolic conditions. The relative contribution of each route varies by tissue, species, and physiological state, and it remains an active area of research.
| Property | Value | Notes |
|---|---|---|
| Solubility | Water-soluble | Polar nucleotide |
| Typical storage | -20°C or below | Desiccated, protected from light |
| Common analytical method | HPLC-UV | Detection near 260 nm |
| Identity confirmation | LC-MS or NMR | Compared with reference standard |
| Purity assessment | HPLC peak area | Method-dependent |
Quality control for NMN materials typically includes appearance, assay, impurity profile, residual solvents, heavy metals, and microbial limits. A certificate of analysis summarizes specified tests, but the underlying methods and laboratory accreditation matter. Regulatory treatment varies by country; NMN is sold as a dietary supplement in some markets, while other jurisdictions restrict its use in foods or classify it differently. Independent verification can reduce risks of mislabeling or substitution. Questions remain about how product purity, storage history, and formulation affect delivered dose in humans.
Solid NMN is a polar, water-soluble nucleotide that can absorb moisture from air. Its phosphate ester is susceptible to hydrolysis, and degradation is faster in aqueous solution, under strongly acidic or alkaline conditions, and at elevated temperatures. For laboratory and commercial handling, the solid is typically kept desiccated, protected from light, and stored frozen. Repeated freeze-thaw cycles can introduce moisture and accelerate breakdown. Stability data for specific formulations should be generated rather than assumed from the parent compound.
The term NMN commonly refers to the beta isomer, in which the nicotinamide group is attached to the ribose through a beta-glycosidic bond. Commercial material may be supplied as the free acid or as a salt, such as a sodium salt, which affects molecular weight and water solubility. Related compounds include nicotinamide riboside and NAD+ itself, but these are distinct molecules with different formulas and cellular handling. Laboratory research often uses the beta form because it matches the naturally occurring configuration found in biological systems.
Small amounts of NMN occur in some foods, including certain vegetables, fruits, and animal products, though the quantities are generally low and variable. Human cells also synthesize NMN internally from nicotinamide and other precursors. Research interest increased after studies examined whether raising NAD+ levels affects metabolism and aging-related pathways in animals. Evidence in humans remains limited and mixed for many outcomes, and questions about effective absorption, tissue delivery, and long-term effects are still open. Regulatory status differs by country, with some markets treating NMN as a supplement ingredient and others restricting its sale.
Nicotinamide mononucleotide, usually shortened to NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide base linked to a ribose sugar that carries a phosphate group. In cells, NMN serves as an intermediate in the salvage pathway that produces nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in many oxidation-reduction reactions, NMN sits near central metabolic processes. The compound is not a drug in most jurisdictions and is discussed mainly in biochemistry and nutrition research.
Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator
Benazepril (Lotensin) Cilazapril (Inhibace) Enalapril (Vasotec/Renitec/Berlipril/Enap/Enalapril Profarma) Imidapril (Tanatril) Lisinopril (Listril/Lopril/Novatec/Prinivil/Zestril, Lisidigal) Moexipril (Univasc) Perindopril (Coversyl/Aceon/Perindo) Quinapril (Accupril) Ramipril (Altace/Prilace/Ramace/Ramiwin/Triatec/Tritace/Ramitac) Trandolapril (Mavik/Odrik/Gopten) Ceronapril (never marketed) Fosinopril (Fositen/Monopril) ACE inhibitor peptides can be derived from natural sources such as algae, fruit, seeds, dairy and animal products. A comprehensive resource on anti-hypertensive peptides is available in the form of a database. It contains around 1700 unique antihypertensive peptides. Arfalasin (HOE 409) is an angiotensin antagonist.
FO is a water insoluble protein with eight subunits and a transmembrane ring. The ring has a tetrameric shape with a helix-loop-helix protein that goes through conformational changes when protonated and deprotonated, pushing neighboring subunits to rotate, causing the spinning of FO which then also affects conformation of F1, resulting in switching of states of alpha and beta subunits. The FO region of ATP synthase is a proton pore that is embedded in the mitochondrial membrane. It consists of three main subunits, a, b, and c. Six c subunits make up the rotor ring, and subunit b makes up a stalk connecting to F1 OSCP that prevents the αβ hexamer from rotating. Subunit a connects b to the c ring. Humans have six additional subunits, d, e, f, g, F6, and 8 (or A6L). This part of the enzyme is located in the mitochondrial inner membrane and couples proton translocation to the rotation that causes ATP synthesis in the F1 region. In eukaryotes, mitochondrial FO forms membrane-bending dimers. These dimers self-arrange into long rows at the end of the cristae, possibly the first step of cristae formation. An atomic model for the dimeric yeast FO region was determined by cryo-EM at an overall resolution of 3.6 Å.
Treatments for ATTR-related neuropathy include TTR-specific oligonucleotides in the form of small interfering RNA (patisiran) or antisense inotersen, the former having recently received FDA approval. Research into treatments for ATTR amyloidosis have compared liver transplantation, oral drugs that stabilize the misfolding protein (including tafamidis and diflunisal), and newer therapeutic agents still being investigated (including patisiran). Based on available research, liver transplant remains the most effective treatment option for advanced ATTR amyloidosis, protein stabilizing drugs may slow disease progression but were insufficient to justify delay of liver transplant, and newer agents such as patisiran require additional studies. Peptide synthesis Proteinopathy
After earning his doctorate in biochemistry, Lehninger held various faculty positions at the University of Wisconsin–Madison and the University of Chicago. In 1952, he went to the Johns Hopkins School of Medicine, assuming the title of DeLamar Professor of the Department of Biological Chemistry. He served in this position until 1978, when he was appointed to the role of University Professor of Medical Sciences. He held this title until his death in 1986. 1948 – Paul-Lewis Award in Enzyme Chemistry 1951 – Guggenheim Fellowship 1956 – Elected to the National Academy of Sciences 1959 – Elected to the American Academy of Arts and Sciences 1969 – Remsen Award of the American Chemical Society 1970 – American Philosophical Society 1986 – Passano Foundation Award Forthcoming in New Dictionary of Scientific Biography
Sources: en.wikipedia.org
ALK-negative ALCL tumor cells show products made by chimeric genes: DUSP22-IRF4 (many of which are fused at particular site and termed DUSP22-FRA7H) in 30% of the cases; TP63-TBL1XR1 in 8% of cases; and NFKB2-ROS1, NCOR2-ROS1, NFKB2-TYK2, or PABPC4-TYK2 in rare cases. They also show mutations in the JAK1 and/or STAT3 genes in 18% of cases; the MSC gene in 15% of cases, and the NOTCH1 gene in 15% of cases. About 24% of cases have a truncated ERBB4 gene. DUSP22 gene rearrangements have been associated with favorable outcomes in ALK-negative ALCL while TP63 gene arrangements are often associated with a poorer prognosis in various cancers. ALK-negative ALCL cells overexpress overactive STAT3 in 47% of cases and JAK1 in many cases. Many of these gene abnormalities appear to contribute to the development of ALK-negative ALCL.
Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Genetically modified organism History of biotechnology An Asilomar Moment Archived 10 July 2013 at the Wayback Machine Original Asilomar Genetics Guidelines “Asilomar Conference.” Provides another summary of the Asilomar Conference. The Basics of Recombinant DNA provides an introduction to the science behind recombinant DNA. The Recombinant DNA Debate Archived 31 March 2007 at the Wayback Machine provides more details about the history of the debate surrounding the use of recombinant DNA technology. “Paul Berg: The 1980 Nobel Prize in Chemistry – Autobiography.” Provides an autobiography about Paul Berg. Science History Institute: The story of the 1975 Asilomar Conference on Recombinant DNA
The AlphaFold Protein Structure Database (AlphaFold DB) is a collaborative project with Google DeepMind to make predicted protein structures from the AlphaFold AI system freely available to the scientific community. The first release of the database was in 2021; as of 2024, AlphaFold DB provides access to over 214 million protein structures. National Center for Biotechnology Information (NCBI), United States National Library of Medicine National Institute of Genetics (DNA Data Bank of Japan) Swiss Institute of Bioinformatics (SIB: Expasy) Australia Bioinformatics Resource BIG Data Center (National Genomics Data Center), Beijing Institute of Genomics, Chinese Academy of Sciences Alternative splicing and transcript diversity database BioJS - open-source project for bioinformatics data on the web BioSamples European Molecular Biology Organization European Nucleotide Archive
Sources: en.wikipedia.org
The renin–angiotensin–aldosterone system is a major blood pressure regulating mechanism. Markers of electrolyte and water imbalance in the body such as hypotension, low distal tubule sodium concentration, decreased blood volume and high sympathetic tone trigger the release of the enzyme renin from the cells of juxtaglomerular apparatus in the kidney. Renin activates a circulating liver derived prohormone angiotensinogen by proteolytic cleavage of all but its first ten amino acid residues known as angiotensin I. ACE (angiotensin converting enzyme) then removes a further two residues, converting angiotensin I into angiotensin II. ACE is found in the pulmonary circulation and in the endothelium of many blood vessels. The system increases blood pressure by increasing the amount of salt and water the body retains. Angiotensin II is also a potent vasoconstrictor.
A 2004 essay on the relation between car colour and safety stated that no previous studies had been scientifically conclusive. Since then, a Swedish study found that pink cars are involved in the fewest and black cars are involved in the most crashes (Land transport NZ 2005). In Auckland New Zealand, a study found that there was a significantly lower rate of serious injury in silver cars, with higher rates in brown, black, and green cars. The Vehicle Colour Study, conducted by Monash University Accident Research Centre (MUARC) and published in 2007, analysed 855,258 crashes that occurring between 1987 and 2004 in the Australian states of Victoria and Western Australia that resulted in injury or in a vehicle being towed away. The study analysed risk by light condition. It found that in daylight, black cars were 12% more likely than white to be involved in a collision, followed by grey cars at 11%, silver cars at 10%, and red and blue cars at 7%, with no other colours found to be significantly more or less risky than white. At dawn or dusk, the risk ratio for black cars jumped to 47% more likely than white, and that for silver cars to 15%. In the hours of darkness, only red and silver cars were found to be significantly more risky than white, by 10% and 8% respectively.
Mike Evans tied the record for consecutive seasons with at least 1,000 receiving yards, with 11. He shares this record with Jerry Rice. Evans also extended his own record of most such seasons to start his career. Aaron Rodgers became the fifth player to have 500 passing touchdowns. Trey McBride set the record for most receptions by a tight end in his first three seasons, with 221. The previous record of 216 was held by George Kittle. The Buffalo Bills became the first team to score at least 30 rushing touchdowns and at least 30 passing touchdowns in a season. Wild Card Round
Skeletal anomalies aren't present at birth but develop in the individual and include delayed bone maturation, slender long tubular bones, and tall vertebral bodies. Joint hyper-mobility and increased risk of hip dislocation has been presented in individuals. Abnormal spinal curvature, either kyhoscholiosis or hyperlordosis, causing back pain can also be experienced from this disorder. Additional physical abnormalities include an abnormally short broad neck and thorax, square shoulders, flared shoulder blades, unusual curving of the 5th finger, and prominent heels can be seen in some children. In some cases, males have been reported to have impaired fertility due to the reduced production of sex hormones and hypospadias which is when the opening of the urethra is on the underside of the penis instead of the tip. In contrast, females are reported to have normal ovarian function with this disorder.
Sources: en.wikipedia.org
NMN is commonly detected by HPLC-UV, LC-MS, or LC-MS/MS. These methods separate the compound from related substances and identify it by retention time and mass.
Laboratory samples are typically stored at -20°C or below, protected from light and moisture. Solutions are usually prepared fresh because they can degrade more quickly than the solid.
Purity depends on the analytical method, detection wavelength, and integration parameters. A value from one laboratory may not be directly comparable to another without method details.
NMN stands for nicotinamide mononucleotide. It is a naturally occurring nucleotide and an intermediate in the cellular production of NAD+.